β-Endorphin, equine
β-Endorphin, equine is an endogenous opioid peptide with analgesic properties.
Online Inquiry
| CAT# | R1796 |
| CAS | 79495-86-6 |
| M.F/Formula | C154H248N42O44S |
| M.W/Mr. | 3423.94 |
| Sequence | One Letter Code: YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Three Letter Code: Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln |
| Appearance | White or off-white lyophilized powder |
| Purity | ≥98% (HPLC) |
| Activity | beta-Endorphin, equine is 1.6 times more potent than the human hormone in the mouse tail-flick assay [1]. |
| Source# | Synthetic |
Storage | -20 degrees Celsius away from light |
Shipping Condition | Shipped at room temperature |
References | [1] Li, CH; et al., Int. J. Peptide Protein Res., 18, 242 (1981). |
Write a review
Ask a question
My Review for β-Endorphin, equine
Required fields are marked with *
×
Ask a Question for β-Endorphin, equine
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
