CAT# | E10004 |
M.F/Formula | C179H277N47O59S1 |
M.W/Mr. | 4063.6 |
Sequence | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...