CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.
CAT# | R1306 |
CAS | 92307-52-3 |
Synonyms/Alias | Corticotropin Releasing Factor bovine |
M.F/Formula | C₂₀₆H₃₄₀N₆₀O₆₃S |
M.W/Mr. | 4697.34 |
Sequence | One Letter Code: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 three Letter Code: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...