Tel: 1-631-624-4882
Email: info@creative-peptides.com

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

This is a peptide derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice,RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: GR1902

Synonyms/Alias: 1678417-57-6;RVG-9R trifluoroacetate salt H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC201H334N82O55S2
M.W/Mr.4843
SequenceOne Letter Code:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Three Letter Code:H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
Long-term Storage ConditionsFreely soluble in water. Avoid repeated freezing and thawing.
InChIInChI=1S/C201H334N82O55S2/c1-10-98(3)150(276-173(321)130(87-149(301)302)267-176(324)134(97-339)274-180(328)138-55-34-79-283(138)188(336)154(103(8)288)275-147(298)94-249-177(325)135-52-31-76-280(135)185(333)123(50-29-74-241-200(227)228)264-179(327)137-54-33-78-282(137)187(335)131(86-141(206)292)271-169(317)122(60-61-148(299)300)262-178(326)136-53-32-77-281(136)186(334)124(62-80-340-9)263-170(318)127(83-106-88-243-110-38-16-15-37-108(106)110)269-182(330)151(99(4)11-2)277-184(332)153(102(7)287)278-156(304)109(203)81-105-56-58-107(289)59-57-105)181(329)268-126(82-104-35-13-12-14-36-104)172(320)279-152(101(6)286)183(331)270-129(85-140(205)291)171(319)273-133(96-285)174(322)253-111(40-19-64-231-190(207)208)157(305)248-93-146(297)251-112(39-17-18-63-202)160(308)254-114(42-21-66-233-192(211)212)159(307)250-100(5)155(303)272-132(95-284)175(323)266-128(84-139(204)290)158(306)247-91-144(295)245-89-142(293)244-90-143(294)246-92-145(296)252-113(41-20-65-232-191(209)210)161(309)255-115(43-22-67-234-193(213)214)162(310)256-116(44-23-68-235-194(215)216)163(311)257-117(45-24-69-236-195(217)218)164(312)258-118(46-25-70-237-196(219)220)165(313)259-119(47-26-71-238-197(221)222)166(314)260-120(48-27-72-239-198(223)224)167(315)261-121(49-28-73-240-199(225)226)168(316)265-125(189(337)338)51-30-75-242-201(229)230/h12-16,35-38,56-59,88,98-103,109,111-138,150-154,243,284-289,339H,10-11,17-34,39-55,60-87,89-97,202-203H2,1-9H3,(H2,204,290)(H2,205,291)(H2,206,292)(H,244,293)(H,245,295)(H,246,294)(H,247,306)(H,248,305)(H,249,325)(H,250,307)(H,251,297)(H,252,296)(H,253,322)(H,254,308)(H,255,309)(H,256,310)(H,257,311)(H,258,312)(H,259,313)(H,260,314)(H,261,315)(H,262,326)(H,263,318)(H,264,327)(H,265,316)(H,266,323)(H,267,324)(H,268,329)(H,269,330)(H,270,331)(H,271,317)(H,272,303)(H,273,319)(H,274,328)(H,275,298)(H,276,321)(H,277,332)(H,278,304)(H,279,320)(H,299,300)(H,301,302)(H,337,338)(H4,207,208,231)(H4,209,210,232)(H4,211,212,233)(H4,213,214,234)(H4,215,216,235)(H4,217,218,236)(H4,219,220,237)(H4,221,222,238)(H4,223,224,239)(H4,225,226,240)(H4,227,228,241)(H4,229,230,242)/t98-,99-,100-,101+,102+,103+,109-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,150-,151-,152-,153-,154-/m0/s1
InChI KeyDBGVIKDHBPWMLR-ICHOMJBYSA-N
Write a review Ask a question

My Review for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×

Ask a Question for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Thymosin β4 Acetate

    Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Deslorelin

    Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

    Inquiry
  • Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x