CAT# | AF2925 |
Sequence | AKRGGFWRKVGRKLGKGIRKIGKTIKSQLGKFRPRLQYRYQF |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...