CAP-18, rabbit
This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Online Inquiry
| CAT# | AF3343 |
| M.W/Mr. | 4433.7 |
| Sequence | One Letter Code: GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Three Letter Code: H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH |
| Storage | -20°C |
References | Travis, S et al. Infect. Immun. 68, 2748 (2000). |
Write a review
Ask a question
My Review for CAP-18, rabbit
Required fields are marked with *
×
Ask a Question for CAP-18, rabbit
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
