Keywords Search Google Search Search

α-Bungarotoxin

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R0901
CAS	11032-79-4
M.F/Formula	C338H529N97O105S11
M.W/Mr.	7984.14
Sequence	IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG(Modifications: Disulfide bridge between 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65)
Application	Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs).

CAT#	Product Name	Inquiry
R0914	Xenin 8	Inquiry
R0917	N-Acetyl-O-phosphono-Tyr-Glu Dipentylamide	Inquiry
R0958	Spexin	Inquiry
R0990	[D-Trp8]-γ-MSH	Inquiry
R0992	M 1145	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl tripeptide: A breakthrough ingredient in skin care science

With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

What is Glutathione?

Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: