CAT# | AF2932 |
Sequence | EGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...