Keywords Search Google Search Search

Beta-Amyloid (1-33)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13222
M.W/Mr.	3674
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG

CAT#	Product Name	Inquiry
A13167	Beta-Amyloid (1-20)	Inquiry
A13360	Beta-Amyloid (35-43)	Inquiry
A13015	Beta-Amyloid (1-10), mouse, rat	Inquiry
A13200	Beta-Amyloid (12-42)	Inquiry
A13300	[Pro31]-beta-Amyloid (1-42)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Basic information of Somatostatin

The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Function of corticotropin in the diagnosis of adrenocortical function

Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: