Keywords Search Google Search Search

Beta-Amyloid (1-33)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13222
M.W/Mr.	3674
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG

CAT#	Product Name	Inquiry
A13339	Beta-Amyloid (31-35)	Inquiry
A13256	[Met]-beta-Amyloid (1-38)	Inquiry
A13296	[Val35]-beta-Amyloid (1-42)	Inquiry
A13015	Beta-Amyloid (1-10), mouse, rat	Inquiry
A13048	Beta-Amyloid (14-25)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

GR 64349, A Selective and Potent NK2 Agonist

GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...

Glucagon like peptide-1 (GLP-1)

The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...

Thyrotropin releasing hormone-protirelin

Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: