Keywords Search Google Search Search

Beta-Amyloid (9-42)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13216
M.W/Mr.	3556.2
Sequence	GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

CAT#	Product Name	Inquiry
A13018	Beta-Amyloid (15-23)	Inquiry
A13178	Beta-Amyloid (1-22)	Inquiry
A13017	[Phe34]-beta-Amyloid (25-35)	Inquiry
A13300	[Pro31]-beta-Amyloid (1-42)	Inquiry
A13019	[Ala10]-beta-Amyloid (1-10)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of taltirelin in delayed neuronal death

Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...

The mechanism and effect of hexapeptide-9

of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

Function of FC 131 as CXCR4 antagonists

The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: