CAT# | A13195 |
M.F/Formula | C143H228N38O40S1 |
M.W/Mr. | 3151.7 |
Sequence | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...