CAT# | A13195 |
M.F/Formula | C143H228N38O40S1 |
M.W/Mr. | 3151.7 |
Sequence | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...