Potent and selective Kv3.4 potassium channel blocker (IC50 = 47 nM). Also potent TTX-sensitive sodium channel agonist (EC50 = 3 nM). Exhibits neuroprotective effect.
CAT# | R1056 |
Synonyms/Alias | Blood depressing substance 1 |
M.F/Formula | C210H297N57O56S6 |
M.W/Mr. | 4708.37 |
Sequence | AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH(Disulfide bridge: Cys4 and Cys39,Cys6 and Cys32,Cys22 and Cys40) |
Labeling Target | Potassium channel |
Appearance | White lyophilised solid |
Purity | >95% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...