CAT# | E12006 |
Sequence | AVKLSSDGNYPFDLSKEDGAQPYFMTPRLRFYPI |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...