CAT# | A13258 |
M.F/Formula | C192H291N53O58S1 |
M.W/Mr. | 4301.84 |
Sequence | DAEFRHDSGYEVHHQKLAFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...