CAT# | A13296 |
M.W/Mr. | 4482.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLVVGGVVIA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...