Tuberoinfundibular peptide of 39 residues,human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	T25001
Sequence	SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

CAT#	Product Name	Inquiry
X17770	UP_P01354	Inquiry
X19575	UP_P81173	Inquiry
X19241	UP_P68111	Inquiry
X16068	PM_9234947	Inquiry
X14353	PM_8165652	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Desmopressin

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Function of trifluoroacetyl tripeptide-2 in human skin

Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...

The Function of Dalbavancin in Acute Bacterial Skin and Skin Tissue Infections (ABSSSI)

Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: