CAT# | AF2400 |
Sequence | VSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...