CAT# | AF2308 |
Sequence | SLGSFMKGVGKGLATVGKIVADQFGKLLEAGKG |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...