Effective and selective Cav2.3 (R-type) channel blocker. It inhibits nociceptive c-fibre and aδ-fibre-evoked neuronal responses, and shows antinociceptive effects.
CAT# | R0955 |
CAS | 203460-30-4 |
M.F/Formula | C192H274N52O60S7 |
M.W/Mr. | 4495.01 |
Sequence | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD(Disulfide bridge between Cys7 and Cys21, Cys14 and Cys26, Cys20 and Cys33) |
Labeling Target | CaV2.3 channels |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...