Effective and selective Cav2.3 (R-type) channel blocker. It inhibits nociceptive c-fibre and aδ-fibre-evoked neuronal responses, and shows antinociceptive effects.
CAT# | R0955 |
CAS | 203460-30-4 |
M.F/Formula | C192H274N52O60S7 |
M.W/Mr. | 4495.01 |
Sequence | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD(Disulfide bridge between Cys7 and Cys21, Cys14 and Cys26, Cys20 and Cys33) |
Labeling Target | CaV2.3 channels |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...