CAT# | R1049 |
M.F/Formula | C226H343N61O64S |
M.W/Mr. | 4970.63 |
Sequence | YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...