We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFFAFIPKIISSPLFKTLLSAVGSALSSSGDQE |
Activity | Antimicrobial |
Host Chemicals | Pardachirus marmoratus |
Length | 33 |
2. Myotropic activity of allatostatins in tenebrionid beetles
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com