CAT# | N1945 |
CAS | 383415-80-3 |
M.F/Formula | C₁₆₅H₂₄₉N₄₉O₃₇S |
M.W/Mr. | 3543.17 |
Sequence | One Letter Code: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW three Letter Code: H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp-OH trifluoroacetate salt |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...