L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
CAT# | R1485 |
M.F/Formula | C₁₆₄H₂₈₆N₆₆O₄₀ |
M.W/Mr. | 3822.44 |
Sequence | One Letter Code: DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2 three Letter Code: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...