(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03037
M.F/Formula	C196H308N58O53
M.W/Mr.	4324.96
Sequence	AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY

CAT#	Product Name	Inquiry
P03053	Parathyroid Hormone (1-34), rat	Inquiry
P03020	(Tyr52)-pTH (52-84) (human)	Inquiry
P03006	Parathyroid Hormone (28-48), human	Inquiry
P03005	pTH-Related Protein (1-16) (human, mouse, rat)	Inquiry
P03055	Hypercalcemia Malignancy Factor (1-34), amide, human	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

PAC-113: A clinically active antimicrobial peptide

PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...

The Second-generation Antagonist, GR 82334

GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...

Function of myristoyl pentapeptide-7 in skin and eyelash

Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...

Effects of tripeptide-3 in skin

Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...

Function of (d(CH2)51, Tyr(Me)2, Arg8)-vasopressin in hyponatremia, ventricular tachycardia and defibrillation

(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: