(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03037
M.F/Formula	C196H308N58O53
M.W/Mr.	4324.96
Sequence	AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY

CAT#	Product Name	Inquiry
P03050	(Cys8)-pTH (1-8) (human)	Inquiry
P03057	Hypercalcemia Malignancy Factor (1-34), human	Inquiry
P03031	Parathyroid Hormone (1-34), bovine	Inquiry
P03002	pTH (73-84) (human)	Inquiry
P03020	(Tyr52)-pTH (52-84) (human)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Purotoxin 1, a highly selective blocker of Р2Х3 receptors

Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Tachykinin NK2 receptor antagonist-MEN 10376

MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: