CAT# | AF1861 |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...