CAT# | AF2893 |
Sequence | LEEAGSNDTPVAAHQEMSTESWMMPNHIRQKRQSHISLCRY |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...