CAT# | AF2370 |
Sequence | KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPK |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...