Keywords Search Google Search Search

Hinnavin I

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2832
Sequence	GWKIGKKLEHHGQNIRDGLISAGPAVFAVGQAATIYAAAK
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3186	Esculentin-1A	Inquiry
AF807	Hepcidin-20	Inquiry
AF2073	Penaeidin-1	Inquiry
AF1693	Ranatuerin-2CPb	Inquiry
AF2362	Cecropin-B2	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of icatibant in hereditary angioedema

Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

Function of Histrelin Acetate in Prostate Cancer

Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Function of trifluoroacetyl tripeptide-2 in human skin

Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Artogeia rapae
Length	40