Glucagon-like peptide 1 (7-36) amide (human, rat)
Glucagon-like peptide 1 (7-36) amide (human, rat)
Glucagon-Like Peptide 1 (7-36) Amide is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells.
Online Inquiry
| CAT# | 10-101-265 |
| CAS | 107444-51-9 |
| Synonyms/Alias | GLP-1; GLP-1 (7-36) amide; Insulinotropin |
| M.F/Formula | C149H226N40O45 |
| M.W/Mr. | 3297.67 |
| Sequence | One Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (Modifications: Arg-30 = C-terminal amide)
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Activity | Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. |
| Storage | Desiccate at -20°C |
Solubility | Soluble to 1 mg/ml in water; 10 mM in DMSO |
Shipping Condition | Shipped at room temperature |
InChI Key | DTHNMHAUYICORS-KTKZVXAJSA-N |
Canonical SMILES | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O |
Write a review
Ask a question
My Review for Glucagon-like peptide 1 (7-36) amide (human, rat)
Required fields are marked with *
×
Ask a Question for Glucagon-like peptide 1 (7-36) amide (human, rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
