Keywords Search Google Search Search

GIP, porcine

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G02008
M.W/Mr.	4975.6
Sequence	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

CAT#	Product Name	Inquiry
G02004	Gastric Inhibitory Polypeptide (1-30), porcine	Inquiry
G02011	Acetyl Gastric Inhibitory Peptide (human)	Inquiry
G02010	GIP, mouse, rat	Inquiry
G02007	(Pro3) Gastric Inhibitory Peptide (GIP), human	Inquiry
G02001	[Tyr0] Gastric Inhibitory Peptide (23-42), human	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: