CAT# | G03016 |
M.F/Formula | C130H204N38O31S2 |
M.W/Mr. | 2859.3 |
Sequence | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...