CAT# | G03020 |
M.F/Formula | C190H265N47O51S1 |
M.W/Mr. | 4055.6 |
Sequence | FLPHVFAELSDRKGFVQGNGAVEALHDFYPDWMDF-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...