Tel: 1-631-624-4882
Email: info@creative-peptides.com

Gastric Inhibitory Polypeptide (porcine)

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: G02012

CAS No: 11063-17-5

Synonyms/Alias: Gastric Inhibitory Polypeptide (porcine);11063-17-5;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC225H342N60O66S
M.W/Mr.4976
SequenceOne Letter Code:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Three Letter Code:H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIInChI=1S/C225H342N60O66S/c1-21-113(11)179(284-216(342)164(108-288)277-202(328)150(91-125-62-66-130(292)67-63-125)264-209(335)160(99-176(307)308)273-215(341)163(107-287)278-220(346)181(115(13)23-3)282-212(338)152(90-123-48-29-26-30-49-123)274-222(348)183(120(18)289)279-172(300)105-245-190(316)142(72-77-173(301)302)251-185(311)117(15)247-188(314)133(231)88-124-60-64-129(291)65-61-124)218(344)249-119(17)187(313)253-146(78-85-352-20)198(324)271-158(97-174(303)304)207(333)257-140(58-39-44-83-230)199(325)281-180(114(12)22-2)219(345)260-141(59-45-84-241-225(238)239)192(318)258-144(69-74-166(233)294)196(322)259-145(70-75-167(234)295)197(323)270-159(98-175(305)306)208(334)265-151(89-122-46-27-25-28-47-122)211(337)280-178(112(9)10)217(343)275-156(95-169(236)297)206(332)266-154(93-127-102-243-135-53-34-32-51-132(127)135)204(330)263-149(87-111(7)8)201(327)262-148(86-110(5)6)200(326)248-118(16)186(312)252-143(68-73-165(232)293)195(321)254-136(54-35-40-79-226)189(315)244-104-171(299)250-137(55-36-41-80-227)191(317)255-139(57-38-43-82-229)194(320)276-162(106-286)214(340)272-161(100-177(309)310)210(336)267-153(92-126-101-242-134-52-33-31-50-131(126)134)203(329)256-138(56-37-42-81-228)193(319)268-155(94-128-103-240-109-246-128)205(331)269-157(96-170(237)298)213(339)283-182(116(14)24-4)221(347)285-184(121(19)290)223(349)261-147(224(350)351)71-76-168(235)296/h25-34,46-53,60-67,101-103,109-121,133,136-164,178-184,242-243,286-292H,21-24,35-45,54-59,68-100,104-108,226-231H2,1-20H3,(H2,232,293)(H2,233,294)(H2,234,295)(H2,235,296)(H2,236,297)(H2,237,298)(H,240,246)(H,244,315)(H,245,316)(H,247,314)(H,248,326)(H,249,344)(H,250,299)(H,251,311)(H,252,312)(H,253,313)(H,254,321)(H,255,317)(H,256,329)(H,257,333)(H,258,318)(H,259,322)(H,260,345)(H,261,349)(H,262,327)(H,263,330)(H,264,335)(H,265,334)(H,266,332)(H,267,336)(H,268,319)(H,269,331)(H,270,323)(H,271,324)(H,272,340)(H,273,341)(H,274,348)(H,275,343)(H,276,320)(H,277,328)(H,278,346)(H,279,300)(H,280,337)(H,281,325)(H,282,338)(H,283,339)(H,284,342)(H,285,347)(H,301,302)(H,303,304)(H,305,306)(H,307,308)(H,309,310)(H,350,351)(H4,238,239,241)/t113-,114-,115-,116-,117-,118-,119-,120+,121+,133-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,178-,179-,180-,181-,182-,183-,184-/m0/s1
InChI KeyPLADHAULGRRDGJ-NHFKDGGBSA-N
Write a review Ask a question

My Review for Gastric Inhibitory Polypeptide (porcine)

Required fields are marked with *

  • Basic Information
×

Ask a Question for Gastric Inhibitory Polypeptide (porcine)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Thymosin β4 Acetate

    Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • GLP-1 (7-37) Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-2 as a gut hormone.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • Thymosin β4 Acetate

    Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x