CAT# | AF2506 |
Sequence | ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...