CAT# | AF2871 |
Sequence | DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...