Keywords Search Google Search Search

Fibronectin type-I 3

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	F04003
Sequence	NRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI

CAT#	Product Name	Inquiry
X13061	PM_7511131	Inquiry
X05870	PM_1311427	Inquiry
X04237	PM_11408525	Inquiry
X02038	PH1VV021_03	Inquiry
X16614	PM_9588953	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

What is peptide YY?

The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...

Glucagon like peptide-1 (GLP-1)

The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...

Copper peptides: classification, benefits, and mechanism of action

What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: