We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI |
Length | 44 |
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. High fat diet and GLP-1 drugs induce pancreatic injury in mice
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com