CAT# | AF3070 |
Sequence | DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFINVNCWCET |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...