CAT# | AF2304 |
Sequence | SKWVTPNHAACAAHCLLRGNRGGQCKGTICHCR |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...