CAT# | AF3103 |
Sequence | MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...