CAT# | E05022 |
M.F/Formula | C154H248N42O44S |
M.W/Mr. | 3423.99 |
Sequence | YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...