Keywords Search Google Search Search

Copeptin (human) trifluoroacetate salt

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	C0031
CAS	78362-34-2
M.F/Formula	C₁₇₇H₂₇₉N₄₉O₅₈
M.W/Mr.	4021.46
Sequence	One Letter Code: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY three Letter Code: H-Phe-Arg-Ala-Asp-His-Pro-Phe-Leu-OH trifluoroacetate salt

CAT#	Product Name	Inquiry
X13352	PM_7609787	Inquiry
P36009	Putative exported peptide yydF	Inquiry
X03431	PM_10861385	Inquiry
X18331	UP_P16240	Inquiry
X17903	UP_P05887	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Effect of GRF (Human) Acetate on Growth Hormone

Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...

Purotoxin 1, a highly selective blocker of Р2Х3 receptors

Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Function of carnosine in skin, food and body

Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

Palmitoyl tripeptide: A breakthrough ingredient in skin care science

With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Storage	-20 ± 5 °C