CAT# | C0031 |
CAS | 78362-34-2 |
M.F/Formula | C₁₇₇H₂₇₉N₄₉O₅₈ |
M.W/Mr. | 4021.46 |
Sequence | One Letter Code: ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY three Letter Code: H-Phe-Arg-Ala-Asp-His-Pro-Phe-Leu-OH trifluoroacetate salt |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...