β-CGRP, human TFA
β-CGRP, human TFA is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.
Online Inquiry
| CAT# | R1795 |
| Synonyms/Alias | Human β-CGRP (TFA); CGRP-II (Human) (TFA) |
| M.F/Formula | C₁₆₄H₂₆₈F₃N₅₁O₅₀S₃ |
| M.W/Mr. | 3907.38 |
| Sequence | One Letter Code: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)
three Letter Code: Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7) |
Write a review
Ask a question
My Review for β-CGRP, human TFA
Required fields are marked with *
×
Ask a Question for β-CGRP, human TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
