CAT# | AF2461 |
Sequence | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...