Calcitonin, eel TFA
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
Online Inquiry
| CAT# | R1265 |
| Synonyms/Alias | Thyrocalcitonin eel (TFA) |
| M.F/Formula | C₁₄₈H₂₄₂F₃N₄₃O₄₉S₂ |
| M.W/Mr. | 3528.89 |
| Sequence | One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
Write a review
Ask a question
My Review for Calcitonin, eel TFA
Required fields are marked with *
×
Ask a Question for Calcitonin, eel TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
