C-Type Natriuretic Peptide (1-53), human
C-Type Natriuretic Peptide (1-53), human
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
Online Inquiry
| CAT# | R1312 |
| CAS | 141294-77-1 |
| Synonyms/Alias | CNP-53 (human) |
| M.F/Formula | C₂₅₁H₄₁₇N₈₁O₇₁S₃ |
| M.W/Mr. | 5801.77 |
| Sequence | One Letter Code: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
three Letter Code: Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for C-Type Natriuretic Peptide (1-53), human
Required fields are marked with *
×
Ask a Question for C-Type Natriuretic Peptide (1-53), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
