Big Endothelin-1 (human)
Online Inquiry
| CAT# | E09021 |
| M.F/Formula | C189H282N48O56S5 |
| M.W/Mr. | 4282.94 |
| Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| E09038 |
Endothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt |
|
|
Inquiry |
| B1503 |
Big Endothelin-1 (1-39), bovine |
|
|
Inquiry |
| B1509 |
Big Endothelin-1 (19-38), human |
|
|
Inquiry |
| E09016 |
[Ala1,3,11,16]-Endothelin 1, human |
|
|
Inquiry |
| E09015 |
[Phe22] Big Endothelin-1 (19-37), human |
|
|
Inquiry |
Write a review
Ask a question
My Review for Big Endothelin-1 (human)
Required fields are marked with *
×
Ask a Question for Big Endothelin-1 (human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
