Keywords Search Google Search Search

Beta-Amyloid (2-42)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13286
M.W/Mr.	4399
Sequence	AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

CAT#	Product Name	Inquiry
A12007	[Ala16,17,20]-beta-Amyloid (1-28)	Inquiry
A13368	Beta-Amyloid (11-17)	Inquiry
A13291	[Ala20]-beta-Amyloid (1-42)	Inquiry
A13075	Beta-Amyloid (1-13)	Inquiry
A13120	Beta-Amyloid (2-17)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of DAMME in analgesia

DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Acetyl tetrapeptide: A multifunctional biomimetic peptide

Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: