Keywords Search Google Search Search

[Arg6]-beta-Amyloid (1-42), English Mutation

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13310
M.W/Mr.	4533.2
Sequence	DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

CAT#	Product Name	Inquiry
CAD-004	(Cys0)-Amyloid β-Protein (1-40)	Inquiry
A13262	[Asp22] b-Amyloid (1-40)	Inquiry
A13281	[Arg6]-beta-Amyloid (1-40), England Mutation	Inquiry
A13255	[Gly22]-beta-Amyloid (1-40), Arctic Mutation	Inquiry
CAD-005	Amyloid β-Protein (1-40) S26C	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Function of PMX-53 as an antagonists

PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...

Function of acetyl glutamyl heptapeptide-3 in skin

Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...

An undecapeptite of mollusk origin-Eledoisin

Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: