CAT# | AF2283 |
Sequence | SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...